Skip to main content

New Drug Approvals 2012 - Pt. XVI - Aclidinium bromide (TudorzaTM PressairTM)






ATC Code: R03BB05
Wikipedia: Aclidinium bromide

On July 23th, the FDA approved Aclidinum bromide (Tradename: Tudorza PressairTM; Research Codes: LAS-34273, LAS W-330), a muscarinic acetylcholine M3 receptor antagonist, for the long-term maintenance treatment of bronchospasm associated with chronic obstructive pulmonary disease (COPD).

Chronic obstructive pulmonary disease (COPD) is characterised by the occurrence of chronic bronchitis or emphysema, a pair of commonly co-existing diseases of the lungs in which the airways become narrowed. Bronchial spasms, a sudden constriction of the muscles in the walls of the bronchioles, occur frequently in COPD.

Aclidinum bromide is a long-acting antimuscarinic agent that through the inhibition of the muscarinic acetylcholine M3 receptors present in the airway smooth muscle, leads to bronchodilation, and consequently eases the symptoms of COPD.

The muscarinic acetylcholine M3 receptor (Uniprot: P20309, ChEMBL: CHEMBL245) belongs to the G-protein coupled receptor (GPCR) type 1 family, and binds the endogenous neurotransmitter acethylcoline. Since it is coupled to a Gq protein, its inhibition leads to a decrease of intracellular calcium levels, and consequently smooth muscle relaxation.

>ACM3_HUMAN Muscarinic acetylcholine receptor M3
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL

There is one partially resolved 3D structure for this protein (2CSA), but there are now several relevant homologous structures of other closely related members of the family (see here for a current list of rhodopsin-like GPCR structures).

The -ium USAN/INN stem covers quaternary ammonium compounds. Members of these class include for example tiotropium bromide (ChEMBL ID: CHEMBL1182657), and ipratropium bromide (ChEMBL ID: CHEMBL1615433, which are also anthicholinergic drugs approved for the treatment of COPD.




Aclidinum bromide (IUPAC: [1-(3-phenoxypropyl)-1-azoniabicyclo[2.2.2]octan-3-yl]2-hydroxy-2,2-dithiophen-2-ylacetate bromide; Canonical smiles (for active quaternary amine): OC(C(=O)O[C@H]1C[N+]2(CCCOc3ccccc3)CCC1CC2)(c4cccs4)c5cccs5 ; PubChem: 11467166; Chemspider: 9609381; ChEMBLID: CHEMBL1194325; Standard InChI Key: ASMXXROZKSBQIH-VITNCHFBSA-N) is a synthetic quaternary ammonium compound with one chiral center, a molecular weight of 484.7 Da, 7 hydrogen bond acceptors, 1 hydrogen bond donor, and has an ALogP of 3.4. The compound is therefore fully rule-of-five compliant.

Aclidinum bromide is available as a dry powder inhaler and the recommended daily dose is two oral inhalations of 400 mcg. It has an apparent volume of distribution of 300 L following intravenous administration of 400 mcg, and its absolute bioavailability is approximately 6%. The estimated effective half-life of Aclidinum (t1/2) is 5 to 8 hours.

The major route of metabolism for aclidinum bromide is non-enzymatic and esterases-mediated hydrolysis, being rapidly and extensively converted to its alcohol and dithienylglycolic acid derivatives, neither of which binds to muscarinic receptors - this leads to very low systemic exposure of the active aclidinium species. Excretion of aclidinium bromide is mainly through the urine (54 - 65%) and faeces (20 - 30%), where only 1% is excreted as unchanged aclidinium. The total clearance is approximately 170 L/h after an intravenous dose of aclidinium bromide in young healthy volunteers.

The license holder for TudorzaTM PressairTM is Forest Pharmaceuticals, and the full prescribing information can be found here.

Comments

Andrew said…
In addition to the structure of the peptide mentioned in the post, there's also a recent structure of the M3 receptor in complex with the drug tiotropium. The PDB ID is 4DAJ, and Pubmed ID for the associated publication is 22358844.

Popular posts from this blog

ChEMBL 34 is out!

We are delighted to announce the release of ChEMBL 34, which includes a full update to drug and clinical candidate drug data. This version of the database, prepared on 28/03/2024 contains:         2,431,025 compounds (of which 2,409,270 have mol files)         3,106,257 compound records (non-unique compounds)         20,772,701 activities         1,644,390 assays         15,598 targets         89,892 documents Data can be downloaded from the ChEMBL FTP site:  https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_34/ Please see ChEMBL_34 release notes for full details of all changes in this release:  https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_34/chembl_34_release_notes.txt New Data Sources European Medicines Agency (src_id = 66): European Medicines Agency's data correspond to EMA drugs prior to 20 January 2023 (excluding vaccines). 71 out of the 882 newly added EMA drugs are only authorised by EMA, rather than from other regulatory bodies e.g.

New SureChEMBL announcement

(Generated with DALL-E 3 ∙ 30 October 2023 at 1:48 pm) We have some very exciting news to report: the new SureChEMBL is now available! Hooray! What is SureChEMBL, you may ask. Good question! In our portfolio of chemical biology services, alongside our established database of bioactivity data for drug-like molecules ChEMBL , our dictionary of annotated small molecule entities ChEBI , and our compound cross-referencing system UniChem , we also deliver a database of annotated patents! Almost 10 years ago , EMBL-EBI acquired the SureChem system of chemically annotated patents and made this freely accessible in the public domain as SureChEMBL. Since then, our team has continued to maintain and deliver SureChEMBL. However, this has become increasingly challenging due to the complexities of the underlying codebase. We were awarded a Wellcome Trust grant in 2021 to completely overhaul SureChEMBL, with a new UI, backend infrastructure, and new f

Accessing SureChEMBL data in bulk

It is the peak of the summer (at least in this hemisphere) and many of our readers/users will be on holiday, perhaps on an island enjoying the sea. Luckily, for the rest of us there is still the 'sea' of SureChEMBL data that awaits to be enjoyed and explored for hidden 'treasures' (let me know if I pushed this analogy too far). See here and  here for a reminder of SureChEMBL is and what it does.  This wealth of (big) data can be accessed via the SureChEMBL interface , where users can submit quite sophisticated and granular queries by combining: i) Lucene fields against full-text and bibliographic metadata and ii) advanced structure query features against the annotated compound corpus. Examples of such queries will be the topic of a future post. Once the search results are back, users can browse through and export the chemistry from the patent(s) of interest. In addition to this functionality, we've been receiving user requests for  local (behind the

A python client for accessing ChEMBL web services

Motivation The CheMBL Web Services provide simple reliable programmatic access to the data stored in ChEMBL database. RESTful API approaches are quite easy to master in most languages but still require writing a few lines of code. Additionally, it can be a challenging task to write a nontrivial application using REST without any examples. These factors were the motivation for us to write a small client library for accessing web services from Python. Why Python? We choose this language because Python has become extremely popular (and still growing in use) in scientific applications; there are several Open Source chemical toolkits available in this language, and so the wealth of ChEMBL resources and functionality of those toolkits can be easily combined. Moreover, Python is a very web-friendly language and we wanted to show how easy complex resource acquisition can be expressed in Python. Reinventing the wheel? There are already some libraries providing access to ChEMBL d

New Drug Approvals - Pt. XVII - Telavancin (Vibativ)

The latest new drug approval, on 11th September 2009 was Telavancin - which was approved for the treatment of adults with complicated skin and skin structure infections (cSSSI) caused by susceptible Gram-positive bacteria , including Staphylococcus aureus , both methicillin-resistant (MRSA) and methicillin-susceptible (MSSA) strains. Telavancin is also active against Streptococcus pyogenes , Streptococcus agalactiae , Streptococcus anginosus group (includes S. anginosus, S. intermedius and S. constellatus ) and Enterococcus faecalis (vancomycin susceptible isolates only). Telavancin is a semisynthetic derivative of Vancomycin. Vancomycin itself is a natural product drug, isolated originally from soil samples in Borneo, and is produced by controlled fermentation of Amycolatopsis orientalis - a member of the Actinobacteria . Telavancin has a dual mechanism of action, firstly it inhibits bacterial cell wall synthesis by interfering with the polymerization and cross-linking of peptid